Explore
Validate
LearnABIN502032
antibody from antibodies-online
Targeting: RBM38
dJ800J21.2, HSRNASEB, RNPC1, seb4B, SEB4D
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502032 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-RNA Binding Motif Protein 38 (RBM38) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RBM38 antibody: synthetic peptide directed towards the middle region of human RBM38
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
QYPYAASPATAASFVGYSYPAAVPQALSAAAPAGT
TFVQY QAPQLQPDRM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references RBM38 is a direct transcriptional target of E2F1 that limits E2F1-induced proliferation.
RNPC1, an RNA-binding protein and a target of the p53 family, is required for maintaining the stability of the basal and stress-induced p21 transcript.
Feldstein O, Ben-Hamo R, Bashari D, Efroni S, Ginsberg D
Molecular cancer research : MCR 2012 Sep;10(9):1169-77
Molecular cancer research : MCR 2012 Sep;10(9):1169-77
RNPC1, an RNA-binding protein and a target of the p53 family, is required for maintaining the stability of the basal and stress-induced p21 transcript.
Shu L, Yan W, Chen X
Genes & development 2006 Nov 1;20(21):2961-72
Genes & development 2006 Nov 1;20(21):2961-72
No comments: Submit comment
No validations: Submit validation data