HPA031880

LCLAT1 antibody from MilliporeSigma / Merck KGaA
AGPAT8, ALCAT1, FLJ37965, LYCAT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031880
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031880, RRID:AB_10610002
Product name
Anti-LCLAT1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031880
Antibody type
Polyclonal
Antigen
lysocardiolipin acyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNI
PQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDL
QLWCHKR
Storage
-20C
Provider Type Product Number
- No reagents -