HPA014535

ABCA10 antibody from Sigma-Aldrich
EST698739
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014535
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014535, RRID:AB_1844426
Product name
Anti-ABCA10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014535
Antibody type
Polyclonal
Antigen
ATP-binding cassette sub-family A member 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MYKVTRETHCWEFSPSMYFLSLEQIPKTPLTSLLI
VNNTGSNIEDLVHSLKCQDIVLEIDDFRNRNGSDD
PSYNGAIIVSGDQKDYRFSVACNTKKLNC
Storage
-20C
Provider Type Product Number
- No reagents -