Antibody data

Product number
H00055964-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055964-M03, RRID:AB_566167
Product name
SEPT3 monoclonal antibody (M03), clone 4D8
Provider product page
Abnova Corporation - H00055964-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SEPT3.
Antigen sequence
TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTP
WGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHN
IHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATP
CPTAE
Isotype
IgG
Antibody clone number
4D8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -