Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055964-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055964-M03, RRID:AB_566167
- Product name
- SEPT3 monoclonal antibody (M03), clone 4D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SEPT3.
- Antigen sequence
TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTP
WGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHN
IHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATP
CPTAE- Isotype
- IgG
- Antibody clone number
- 4D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SEPT3 monoclonal antibody (M03), clone 4D8 Western Blot analysis of SEPT3 expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SEPT3 monoclonal antibody (M03), clone 4D8. Western Blot analysis of SEPT3 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SEPT3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol