HPA031974

antibody from Atlas Antibodies

Targeting: PIEZO2 C18orf30, C18orf58, FAM38B, FAM38B2, FLJ23144, FLJ23403, FLJ34907, HsT748, HsT771

Antibody data

Submit

Validation data

Product number: HPA031974 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA031974, RRID:AB_10603675
Product name: Anti-PIEZO2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEE DFNGGDGVEGELEESTKLKMFRRLASVASKLK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PIEZO2 protein structure - HPA031974 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human gallbladder and skeletal muscle tissues using HPA031974 antibody. Corresponding PIEZO2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong membranous positivity in smooth muscle cells and weak in glandular cells..
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong membranous positivity in pneumocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak to moderate membranous positivity in Leydig cells and cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human gallbladder shows strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.
Sample type: HUMAN