Explore
Validate
LearnHPA031974
antibody from Atlas Antibodies
Targeting: PIEZO2
C18orf30, C18orf58, FAM38B, FAM38B2, FLJ23144, FLJ23403, FLJ34907, HsT748, HsT771
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031974 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031974, RRID:AB_10603675
- Product name
- Anti-PIEZO2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEE
DFNGGDGVEGELEESTKLKMFRRLASVASKLK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Piezo2 is not an indispensable mechanosensor in murine cardiomyocytes
Five miRNAs-mediated PIEZO2 downregulation, accompanied with activation of Hedgehog signaling pathway, predicts poor prognosis of breast cancer
Tuning Piezo ion channels to detect molecular-scale movements relevant for fine touch
Kloth B, Mearini G, Weinberger F, Stenzig J, Geertz B, Starbatty J, Lindner D, Schumacher U, Reichenspurner H, Eschenhagen T, Hirt M
Scientific Reports 2022;12(1)
Scientific Reports 2022;12(1)
Five miRNAs-mediated PIEZO2 downregulation, accompanied with activation of Hedgehog signaling pathway, predicts poor prognosis of breast cancer
Lou W, Liu J, Ding B, Jin L, Xu L, Li X, Chen J, Fan W
Aging 2019;11(9):2628-2652
Aging 2019;11(9):2628-2652
Tuning Piezo ion channels to detect molecular-scale movements relevant for fine touch
Poole K, Herget R, Lapatsina L, Ngo H, Lewin G
Nature Communications 2014;5(1)
Nature Communications 2014;5(1)
No comments: Submit comment
No validations: Submit validation data