HPA040616
antibody from Atlas Antibodies
Targeting: PIEZO2
C18orf30, C18orf58, FAM38B, FAM38B2, FLJ23144, FLJ23403, FLJ34907, HsT748, HsT771
Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040616 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040616, RRID:AB_2677043
- Product name
- Anti-PIEZO2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FEDENKAAVRIMAGDNVEICMNLDAASFSQHNP
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Prognostic Evaluation of Piezo2 Channels in Mammary Gland Carcinoma
Intraluminal chloride regulates lung branching morphogenesis: involvement of PIEZO1/PIEZO2
Influence of the vestibular system on the neonatal motor behaviors in the gray short-tailed opossum (Monodelphis domestica)
Ageing of the somatosensory system at the periphery: age‐related changes in cutaneous mechanoreceptors
Five miRNAs-mediated PIEZO2 downregulation, accompanied with activation of Hedgehog signaling pathway, predicts poor prognosis of breast cancer
Martín-Sanz R, Rodrigues-Françoso A, García-Mesa Y, García-Alonso F, Gómez-Muñoz M, Malmierca-González S, Salazar-Blázquez R, García-Suárez O, Feito J
Cancers 2024;16(13):2413
Cancers 2024;16(13):2413
Intraluminal chloride regulates lung branching morphogenesis: involvement of PIEZO1/PIEZO2
Gonçalves A, Moura R, Correia-Pinto J, Nogueira-Silva C
Respiratory Research 2023;24(1)
Respiratory Research 2023;24(1)
Influence of the vestibular system on the neonatal motor behaviors in the gray short-tailed opossum (Monodelphis domestica)
Lanthier F, Laforge J, Pflieger J
IBRO Neuroscience Reports 2023;15
IBRO Neuroscience Reports 2023;15
Ageing of the somatosensory system at the periphery: age‐related changes in cutaneous mechanoreceptors
García‐Piqueras J, García‐Mesa Y, Cárcaba L, Feito J, Torres‐Parejo I, Martín‐Biedma B, Cobo J, García‐Suárez O, Vega J
Journal of Anatomy 2019;234(6):839-852
Journal of Anatomy 2019;234(6):839-852
Five miRNAs-mediated PIEZO2 downregulation, accompanied with activation of Hedgehog signaling pathway, predicts poor prognosis of breast cancer
Lou W, Liu J, Ding B, Jin L, Xu L, Li X, Chen J, Fan W
Aging 2019;11(9):2628-2652
Aging 2019;11(9):2628-2652
No comments: Submit comment
No validations: Submit validation data