Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00114757-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00114757-M02, RRID:AB_489782
- Product name
- CYGB monoclonal antibody (M02), clone 1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CYGB.
- Antigen sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLY
ASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL
EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSV
LALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA
SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQV
PNATTPPATLPSSGP- Isotype
- IgG
- Antibody clone number
- 1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references DNA damage induced activation of Cygb stabilizes p53 and mediates G1 arrest.
Cytoglobin has bimodal: tumour suppressor and oncogene functions in lung cancer cell lines.
Pathway specific gene expression profiling reveals oxidative stress genes potentially regulated by transcription co-activator LEDGF/p75 in prostate cancer cells.
Hypoxia differentially regulates the expression of neuroglobin and cytoglobin in rat brain.
p53-mediated apoptosis, neuroglobin overexpression, and globin deposits in a patient with hereditary ferritinopathy.
John R, Chand V, Chakraborty S, Jaiswal N, Nag A
DNA repair 2014 Dec;24:107-12
DNA repair 2014 Dec;24:107-12
Cytoglobin has bimodal: tumour suppressor and oncogene functions in lung cancer cell lines.
Oleksiewicz U, Liloglou T, Tasopoulou KM, Daskoulidou N, Bryan J, Gosney JR, Field JK, Xinarianos G
Human molecular genetics 2013 Aug 15;22(16):3207-17
Human molecular genetics 2013 Aug 15;22(16):3207-17
Pathway specific gene expression profiling reveals oxidative stress genes potentially regulated by transcription co-activator LEDGF/p75 in prostate cancer cells.
Basu A, Drame A, Muñoz R, Gijsbers R, Debyser Z, De Leon M, Casiano CA
The Prostate 2012 May 1;72(6):597-611
The Prostate 2012 May 1;72(6):597-611
Hypoxia differentially regulates the expression of neuroglobin and cytoglobin in rat brain.
Li RC, Lee SK, Pouranfar F, Brittian KR, Clair HB, Row BW, Wang Y, Gozal D
Brain research 2006 Jun 22;1096(1):173-9
Brain research 2006 Jun 22;1096(1):173-9
p53-mediated apoptosis, neuroglobin overexpression, and globin deposits in a patient with hereditary ferritinopathy.
Powers JM
Journal of neuropathology and experimental neurology 2006 Jul;65(7):716-21
Journal of neuropathology and experimental neurology 2006 Jul;65(7):716-21
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CYGB expression in transfected 293T cell line by CYGB monoclonal antibody (M02), clone 1A1.Lane 1: CYGB transfected lysate(21 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CYGB is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CYGB on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CYGB on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol