HPA017757

CYGB antibody from Sigma-Aldrich
HGB, STAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017757
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017757, RRID:AB_1847410
Product name
Anti-CYGB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017757
Antibody type
Polyclonal
Antigen
Cytoglobin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQL
RKHACRVMGALNTVVENLHDPDKVSSVLALVGKAH
ALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQ
RAWAKLRGLIYSHVTAAYKEVGWVQ
Storage
-20C
Provider Type Product Number
- No reagents -