HPA018211

ZSWIM5 antibody from MilliporeSigma / Merck KGaA
KIAA1511
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018211
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA018211, RRID:AB_1859502
Product name
Anti-ZSWIM5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA018211
Antibody type
Polyclonal
Antigen
Zinc finger SWIM domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPID
CLFLTLTEACRLNDDGYLEMSDMNESRPPVYQHVP
VAAGSPNSSESYLSLALEVALMG
Storage
-20C
Provider Type Product Number
- No reagents -