HPA004136

RPL14 antibody from Atlas Antibodies
CTG-B33, hRL14, L14, RL14
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004136
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004136, RRID:AB_1079839
Product name
Anti-RPL14
Provider product page
Atlas Antibodies - HPA004136
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KKMRNRIIKNEVKKLQKAALLKASPKKAPGTKGTA
AAAAAAAAAAAAAAKVPAKKITAASKKAPAQKVPA
QKATGQKAAPAPKAQKGQKAPAQKAPAPKAS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -