HPA004136

RPL14 antibody from Sigma-Aldrich
CTG-B33, hRL14, L14, RL14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004136
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004136, RRID:AB_1079839
Product name
Anti-RPL14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004136
Antibody type
Polyclonal
Antigen
60S ribosomal protein L14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KKMRNRIIKNEVKKLQKAALLKASPKKAPGTKGTA
AAAAAAAAAAAAAAKVPAKKITAASKKAPAQKVPA
QKATGQKAAPAPKAQKGQKAPAQKAPAPKAS
Storage
-20C
Provider Type Product Number
- No reagents -