Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004838-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004838-M04, RRID:AB_530148
- Product name
- NODAL monoclonal antibody (M04), clone 5H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NODAL.
- Antigen sequence
RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVP
STCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEEC
GC- Isotype
- IgG
- Antibody clone number
- 5H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NODAL monoclonal antibody (M04), clone 5H3 Western Blot analysis of NODAL expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NODAL monoclonal antibody (M04), clone 5H3. Western Blot analysis of NODAL expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NODAL is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol