HPA014563

TDRD5 antibody from MilliporeSigma / Merck KGaA
FLJ34823, TUDOR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014563
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014563, RRID:AB_1857868
Product name
Anti-TDRD5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014563
Antibody type
Polyclonal
Antigen
Tudor domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RNSMHKGRPSIYSGPRSHRRVPYRGRVAPILPAVV
KSELKDLLALSPVLLSDFEKAFAKRFGRSFQYMQY
GFLSMFEVLNAASDVISVEQTRAGSLLMLKKSVTE
EKPRGCPAGKI
Storage
-20C
Provider Type Product Number
- No reagents -