HPA014738

KCNF1 antibody from Sigma-Aldrich
IK8, KCNF, kH1, Kv5.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014738
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014738, RRID:AB_1852114
Product name
Anti-KCNF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014738
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily F member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGG
SRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPL
LTEEKHHRTRLQSCK
Storage
-20C
Provider Type Product Number
- No reagents -