HPA014738

KCNF1 antibody from Atlas Antibodies
IK8, KCNF, kH1, Kv5.1

Antibody data

Product number
HPA014738
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014738, RRID:AB_1852114
Product name
Anti-KCNF1
Provider product page
Atlas Antibodies - HPA014738
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VRYYNKQRVLETAAKHELELMELNSSSGGEGKTGG
SRSDLDNLPPEPAGKEAPSCSSRLKLSHSDTFIPL
LTEEKHHRTRLQSCK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.