HPA015629

PBRM1 antibody from Sigma-Aldrich
BAF180, PB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015629
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015629, RRID:AB_1855012
Product name
Anti-PBRM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015629
Antibody type
Polyclonal
Antigen
Protein polybromo-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKA
ACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQG
TVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISE
LFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGS
YKSIHA
Storage
-20C
Provider Type Product Number
- No reagents -