HPA015629

PBRM1 antibody from Atlas Antibodies
BAF180, PB1
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA015629
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015629, RRID:AB_1235094
Product name
Anti-PBRM1
Provider product page
Atlas Antibodies - HPA015629
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKA
ACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQG
TVTEGSSPAYLKEILEQLLEAIVVATNPSGRLISE
LFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNGS
YKSIHA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -