Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056937-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056937-M01, RRID:AB_464250
- Product name
- TMEPAI monoclonal antibody (M01), clone 2A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TMEPAI.
- Antigen sequence
NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSG
GRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLE
GTRLHHTHIAPLESAAIWSKEKDKQKGHPL- Isotype
- IgG
- Antibody clone number
- 2A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mutation or loss of p53 differentially modifies TGFβ action in ovarian cancer.
TGF-β induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer.
TGF-β induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer.
Identification of two distinct carcinoma-associated fibroblast subtypes with differential tumor-promoting abilities in oral squamous cell carcinoma.
TMEPAI regulates EMT in lung cancer cells by modulating the ROS and IRS-1 signaling pathways.
TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling.
Transforming growth factor-beta (TGF-beta)-inducible gene TMEPAI converts TGF-beta from a tumor suppressor to a tumor promoter in breast cancer.
A feedback loop between the androgen receptor and a NEDD4-binding protein, PMEPA1, in prostate cancer cells.
High level expression of STAG1/PMEPA1 in an androgen-independent prostate cancer PC3 subclone.
Ó hAinmhire E, Quartuccio SM, Cheng W, Ahmed RA, King SM, Burdette JE
PloS one 2014;9(2):e89553
PloS one 2014;9(2):e89553
TGF-β induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer.
Singha PK, Pandeswara S, Geng H, Lan R, Venkatachalam MA, Saikumar P
Genes & cancer 2014 Sep;5(9-10):320-36
Genes & cancer 2014 Sep;5(9-10):320-36
TGF-β induced TMEPAI/PMEPA1 inhibits canonical Smad signaling through R-Smad sequestration and promotes non-canonical PI3K/Akt signaling by reducing PTEN in triple negative breast cancer.
Singha PK, Pandeswara S, Geng H, Lan R, Venkatachalam MA, Saikumar P
Genes & cancer 2014 Sep;5(9-10):320-36
Genes & cancer 2014 Sep;5(9-10):320-36
Identification of two distinct carcinoma-associated fibroblast subtypes with differential tumor-promoting abilities in oral squamous cell carcinoma.
Costea DE, Hills A, Osman AH, Thurlow J, Kalna G, Huang X, Pena Murillo C, Parajuli H, Suliman S, Kulasekara KK, Johannessen AC, Partridge M
Cancer research 2013 Jul 1;73(13):3888-901
Cancer research 2013 Jul 1;73(13):3888-901
TMEPAI regulates EMT in lung cancer cells by modulating the ROS and IRS-1 signaling pathways.
Hu Y, He K, Wang D, Yuan X, Liu Y, Ji H, Song J
Carcinogenesis 2013 Aug;34(8):1764-72
Carcinogenesis 2013 Aug;34(8):1764-72
TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling.
Watanabe Y, Itoh S, Goto T, Ohnishi E, Inamitsu M, Itoh F, Satoh K, Wiercinska E, Yang W, Shi L, Tanaka A, Nakano N, Mommaas AM, Shibuya H, Ten Dijke P, Kato M
Molecular cell 2010 Jan 15;37(1):123-34
Molecular cell 2010 Jan 15;37(1):123-34
Transforming growth factor-beta (TGF-beta)-inducible gene TMEPAI converts TGF-beta from a tumor suppressor to a tumor promoter in breast cancer.
Singha PK, Yeh IT, Venkatachalam MA, Saikumar P
Cancer research 2010 Aug 1;70(15):6377-83
Cancer research 2010 Aug 1;70(15):6377-83
A feedback loop between the androgen receptor and a NEDD4-binding protein, PMEPA1, in prostate cancer cells.
Li H, Xu LL, Masuda K, Raymundo E, McLeod DG, Dobi A, Srivastava S
The Journal of biological chemistry 2008 Oct 24;283(43):28988-95
The Journal of biological chemistry 2008 Oct 24;283(43):28988-95
High level expression of STAG1/PMEPA1 in an androgen-independent prostate cancer PC3 subclone.
Hirokawa YS, Takagi A, Uchida K, Kozuka Y, Yoneda M, Watanabe M, Shiraishi T
Cellular & molecular biology letters 2007 Sep;12(3):370-7
Cellular & molecular biology letters 2007 Sep;12(3):370-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TMEPAI is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol