Antibody data

Product number
H00008013-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008013-M02, RRID:AB_913721
Product name
NR4A3 monoclonal antibody (M02), clone 1E9
Provider product page
Abnova Corporation - H00008013-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NR4A3.
Antigen sequence
LDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVS
RSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLS
IRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIK
DFS
Isotype
IgG
Antibody clone number
1E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.