HPA043032

H2-KE2, HKE2, KE-2, PFD6

Antibody data

Submit

Validation data

Product number: HPA043032
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043032, RRID:AB_2678278
Product name: Anti-PFDN6
Provider product page: Atlas Antibodies - HPA043032
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENN IVKEELALLDGSNVVFKLLGPVLVKQELG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas using Anti-PFDN6 antibody HPA043032.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PFDN6 antibody HPA043032.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-PFDN6 antibody HPA043032.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PFDN6 antibody HPA043032.
Sample type: HUMAN

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, pancreas and testis using Anti-PFDN6 antibody HPA043032 (A) shows similar protein distribution across tissues to independent antibody HPA048123 (B).
Antibody #2 product nr: HPA048123
Antibody provider: Atlas Antibodies