Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005863-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005863-M02, RRID:AB_535007
- Product name
- RGL2 monoclonal antibody (M02), clone 4D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RGL2.
- Antigen sequence
PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPS
VISRVLKKNNRDSAVASEYELVQLLPGERELTIPA
SANVFYAMDGASHDFLLRQRRRSSTATPGV- Isotype
- IgG
- Antibody clone number
- 4D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references M-Ras induces Ral and JNK activation to regulate MEK/ERK-independent gene expression in MCF-7 breast cancer cells.
Aberrant overexpression of the Rgl2 Ral small GTPase-specific guanine nucleotide exchange factor promotes pancreatic cancer growth through Ral-dependent and Ral-independent mechanisms.
Castro AF, Campos T, Babcock JT, Armijo ME, MartÃnez-Conde A, Pincheira R, Quilliam LA
Journal of cellular biochemistry 2012 Apr;113(4):1253-64
Journal of cellular biochemistry 2012 Apr;113(4):1253-64
Aberrant overexpression of the Rgl2 Ral small GTPase-specific guanine nucleotide exchange factor promotes pancreatic cancer growth through Ral-dependent and Ral-independent mechanisms.
Vigil D, Martin TD, Williams F, Yeh JJ, Campbell SL, Der CJ
The Journal of biological chemistry 2010 Nov 5;285(45):34729-40
The Journal of biological chemistry 2010 Nov 5;285(45):34729-40
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RGL2 monoclonal antibody (M02), clone 4D10 Western Blot analysis of RGL2 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RGL2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RGL2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol