HPA014569

CCDC186 antibody from Sigma-Aldrich
C10orf118, FLJ10188, FLJ35301
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014569
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014569, RRID:AB_2066352
Product name
Anti-C10orf118 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014569
Antibody type
Polyclonal
Antigen
Uncharacterized protein C10orf118 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRSSTFPESANEKTYSESPYDTDCTKKFISKIKSV
SASEDLLEEIESELLSTEFAEHRVPNGMNKGEHAL
VLFEKCVQDKYLQQEHIIKKLIKENKKHQELFVDI
CSEKDNLREELKKRTETEK
Storage
-20C
Provider Type Product Number
- No reagents -