HPA014569

CCDC186 antibody from Atlas Antibodies
C10orf118, CCCP-1, FLJ10188, FLJ35301, golgin104
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014569
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014569, RRID:AB_2066352
Product name
Anti-CCDC186
Provider product page
Atlas Antibodies - HPA014569
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRSSTFPESANEKTYSESPYDTDCTKKFISKIKSV
SASEDLLEEIESELLSTEFAEHRVPNGMNKGEHAL
VLFEKCVQDKYLQQEHIIKKLIKENKKHQELFVDI
CSEKDNLREELKKRTETEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -