Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051491-D01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051491-D01, RRID:AB_10718340
- Product name
- NOP16 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human NOP16 protein.
- Antigen sequence
MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIE
CSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK
RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPE
KKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY
YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKM
EVE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Molecular characterizations of Nop16 in murine mammary tumors with varying levels of c-Myc.
Kundel DW, Stromquist E, Greene AL, Zhdankin O, Regal RR, Rose-Hellekant TA
Transgenic research 2012 Apr;21(2):393-406
Transgenic research 2012 Apr;21(2):393-406
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HSPC111 MaxPab rabbit polyclonal antibody. Western Blot analysis of HSPC111 expression in mouse spleen.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NOP16 expression in transfected 293T cell line (H00051491-T03) by NOP16 MaxPab polyclonal antibody.Lane 1: NOP16 transfected lysate(21.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to NOP16 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of NOP16 transfected lysate using anti-NOP16 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NOP16 purified MaxPab mouse polyclonal antibody (B01P) (H00051491-B01P).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol