Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA021057 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA021057, RRID:AB_1848586
- Product name
- Anti-FBN1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGR
CWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRP
EYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEY
LYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTP
GSCRCEC- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Epithelial-mesenchymal status influences how cells deposit fibrillin microfibrils.
Network-based survival analysis reveals subnetwork signatures for predicting outcomes of ovarian cancer treatment.
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Baldwin AK, Cain SA, Lennon R, Godwin A, Merry CL, Kielty CM
Journal of cell science 2014 Jan 1;127(Pt 1):158-71
Journal of cell science 2014 Jan 1;127(Pt 1):158-71
Network-based survival analysis reveals subnetwork signatures for predicting outcomes of ovarian cancer treatment.
Zhang W, Ota T, Shridhar V, Chien J, Wu B, Kuang R
PLoS computational biology 2013;9(3):e1002975
PLoS computational biology 2013;9(3):e1002975
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Edlund K, Lindskog C, Saito A, Berglund A, Pontén F, Göransson-Kultima H, Isaksson A, Jirström K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Östman A, Micke P
International Journal of Cancer 2012 November;131(10):2264-2273
International Journal of Cancer 2012 November;131(10):2264-2273
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cervix, uterine and cerebral cortex tissues using HPA021057 antibody. Corresponding FBN1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong positivity in extracellular matrix.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong positivity in extracellular matrix.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows positivity in extracellular matrix.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows no cytoplasmic positivity as expected.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows moderate extracellular space positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows no positivity as expected.
- Sample type
- HUMAN