HPA021057

FBN1 antibody from Atlas Antibodies
FBN, MASS, MFS1, OCTD, SGS, WMS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021057
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021057, RRID:AB_1848586
Product name
Anti-FBN1
Provider product page
Atlas Antibodies - HPA021057
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGR
CWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRP
EYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEY
LYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTP
GSCRCEC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -