HPA021057

FBN1 antibody from Atlas Antibodies
FBN, MASS, MFS1, OCTD, SGS, WMS

Antibody data

Product number
HPA021057
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021057, RRID:AB_1848586
Product name
Anti-FBN1
Provider product page
Atlas Antibodies - HPA021057
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGR
CWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRP
EYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEY
LYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTP
GSCRCEC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.