Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002200-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002200-M01, RRID:AB_581680
- Product name
- FBN1 monoclonal antibody (M01), clone 3H6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FBN1.
- Antigen sequence
- SNKVRILELLPALTTLTNHNRYLIESGNEDGFFKI
 NQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKE
 LNQLEDKYDKDYLSGELGDNLKMKIQVLLH
- Isotype
- IgG
- Antibody clone number
- 3H6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged FBN1 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunoperoxidase of monoclonal antibody to FBN1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol