Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90584 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90584, RRID:AB_2665596
- Product name
- Anti-FBN1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
DVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGR
CWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRP
EYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEY
LYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTP
GSCRCEC- Epitope
- Binds to an epitope located within the peptide sequence KMQCCCDAGRCWSPG as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0225
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human tonsil tissue lysate
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong immunoreactivity in the extracellular matrix of seminiferous tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong immunoreactivity in the basement membranes and extracellular matrix, but not in the glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong immunoreactivity in the extracellular matrix, but not in the epithelial cells.