HPA021057

FBN1 antibody from Sigma-Aldrich
FBN, MASS, MFS1, OCTD, SGS, WMS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021057
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021057, RRID:AB_1848586
Product name
Anti-FBN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021057
Antibody type
Polyclonal
Antigen
Fibrillin-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVRPGYCYTALTNGRCSNQLPQSITKMQCCCDAGR
CWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRP
EYPPPPLGPIPPVLPVPPGFPPGPQIPVPRPPVEY
LYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTP
GSCRCEC
Storage
-20C
Provider Type Product Number
- No reagents -