HPA017759

FBN1 antibody from Atlas Antibodies
FBN, MASS, MFS1, OCTD, SGS, WMS

Antibody data

Product number
HPA017759
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017759, RRID:AB_1848584
Product name
Anti-FBN1
Provider product page
Atlas Antibodies - HPA017759
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HCVSGMGMGRGNPEPPVSGEMDDNSLSPEACYECK
INGYPKRGRKRRSTNETDASNIEDQSETEANVSLA
SWDVEKTAIFAFNISHVSNKVRILELLPALTTLTN
HNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVA
GTYSLQISS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.