Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079047-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079047-B01P, RRID:AB_1678302
- Product name
- KCTD15 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human KCTD15 protein.
- Antigen sequence
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRS
PVSPLAAQGIPLPAQLTKSNAPVHIDVGSHMYTSS
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDR
DGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTP
DLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN
QDPTHVIRFPLNGYCRLNSVQDVL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The BTB-containing protein Kctd15 is SUMOylated in vivo.
Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
Zarelli VE, Dawid IB
PloS one 2013;8(9):e75016
PloS one 2013;8(9):e75016
Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
Zarelli VE, Dawid IB
Proceedings of the National Academy of Sciences of the United States of America 2013 Feb 19;110(8):2870-5
Proceedings of the National Academy of Sciences of the United States of America 2013 Feb 19;110(8):2870-5
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of KCTD15 expression in transfected 293T cell line (H00079047-T02) by KCTD15 MaxPab polyclonal antibody.Lane 1: KCTD15 transfected lysate(25.74 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- KCTD15 MaxPab polyclonal antibody. Western Blot analysis of KCTD15 expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to KCTD15 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol