Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001212-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001212-M01, RRID:AB_425372
- Product name
- CLTB monoclonal antibody (M01), clone 4B12-1E3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CLTB.
- Antigen sequence
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEI
AGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT
TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRK
WREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN
QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWE
KVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLS
R- Isotype
- IgG
- Antibody clone number
- 4B12-1E3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CLTB monoclonal antibody (M01), clone 4B12-1E3 Western Blot analysis of CLTB expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CLTB expression in transfected 293T cell line by CLTB monoclonal antibody (M01), clone 4B12-1E3.Lane 1: CLTB transfected lysate(23.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLTB is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CLTB on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CLTB on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol