Antibody data

Product number
H00057403-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057403-M03, RRID:AB_1137002
Product name
RAB22A monoclonal antibody (M03), clone 2B12
Provider product page
Abnova Corporation - H00057403-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RAB22A.
Antigen sequence
MALRELRVCLLGDTGVGKSSIVWRFVEDSFDPNIN
PTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRR
HGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI
HAIFVETSAKNAININELFIEISRRIPSTDANLPS
GGKGFKLRRQPSEPKRSCC
Isotype
IgG
Antibody clone number
2B12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -