Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN971511 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-RAB14, Member RAS Oncogene Family (RAB14) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-RAB14 antibody: synthetic peptide directed towards the C terminal of human RAB14
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQG
GRLTS EPQPQREGCG- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Impaired ubiquitin-proteasome-mediated PGC-1α protein turnover and induced mitochondrial biogenesis secondary to complex-I deficiency.
Identification of direct targets for the miR-17-92 cluster by proteomic analysis.
Rab14 is involved in membrane trafficking between the Golgi complex and endosomes.
Farhoud MH, Nijtmans LG, Wanders RJ, Wessels HJ, Lasonder E, Janssen AJ, Rodenburg RR, van den Heuvel LP, Smeitink JA
Proteomics 2012 May;12(9):1349-62
Proteomics 2012 May;12(9):1349-62
Identification of direct targets for the miR-17-92 cluster by proteomic analysis.
Kanzaki H, Ito S, Hanafusa H, Jitsumori Y, Tamaru S, Shimizu K, Ouchida M
Proteomics 2011 Sep;11(17):3531-9
Proteomics 2011 Sep;11(17):3531-9
Rab14 is involved in membrane trafficking between the Golgi complex and endosomes.
Junutula JR, De Maziére AM, Peden AA, Ervin KE, Advani RJ, van Dijk SM, Klumperman J, Scheller RH
Molecular biology of the cell 2004 May;15(5):2218-29
Molecular biology of the cell 2004 May;15(5):2218-29
No comments: Submit comment
No validations: Submit validation data