Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056993-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056993-M01, RRID:AB_519123
- Product name
- TOMM22 monoclonal antibody (M01), clone 4G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant TOMM22.
- Antigen sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEED
DDEELDETLSERLWGLTEMFPERVRSAAGATFDLS
LFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEK
LQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPG
KI- Isotype
- IgG
- Antibody clone number
- 4G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TOMM22 monoclonal antibody (M01), clone 4G4 Western Blot analysis of TOMM22 expression in NIH/3T3 ( Cat # L018V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody (M01), clone 4G4.Lane 1: TOMM22 transfected lysate(15.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TOMM22 monoclonal antibody (M01), clone 4G4. Western Blot analysis of TOMM22 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TOMM22 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol