HPA003037

TOMM22 antibody from Atlas Antibodies
TOM22
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA003037
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003037, RRID:AB_1080329
Product name
Anti-TOMM22
Provider product page
Atlas Antibodies - HPA003037
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEED
DDEELDETLSERLWGLTEMFPERVRSAAGATFDLS
LFVAQK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -