Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [4]
- Immunocytochemistry [2]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003037 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003037, RRID:AB_1080329
- Product name
- Anti-TOMM22
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEED
DDEELDETLSERLWGLTEMFPERVRSAAGATFDLS
LFVAQK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Global variability in gene expression and alternative splicing is modulated by mitochondrial content
Skeletal muscle stem cells adopt a dormant cell state post mortem and retain regenerative capacity
Guantes R, Rastrojo A, Neves R, Lima A, Aguado B, Iborra F
Genome Research 2015 May;25(5):633-644
Genome Research 2015 May;25(5):633-644
Skeletal muscle stem cells adopt a dormant cell state post mortem and retain regenerative capacity
Latil M, Rocheteau P, Châtre L, Sanulli S, Mémet S, Ricchetti M, Tajbakhsh S, Chrétien F
Nature Communications 2012 June;3
Nature Communications 2012 June;3
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- klas2
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot of cell lysate from U-2 OS cells transfected with either siRNA targeting TOMM22 or control siRNA. Lane 1: Marker (250, 130, 95, 72, 55, 36, 28, 17, 10) Lane 2: Cell lysate from U-2OS cells transfected with siRNA targeting TOMM22 Lane 3: N/A Lane 4: Cell lysate from U-2OS cells transfected with control siRNA Right image, lane 1-4: loading control
- Sample type
- U-2 OS
- Primary Ab dilution
- 1:311
- Conjugate
- Horseradish Peroxidase
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:3000
- Knockdown/Genetic Approaches Application
- Western blot
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TOMM22 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line HL-60.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
- Sample type
- MOUSE, RAT
Enhanced validation
Supportive validation
- Submitted by
- 55af80e3e0991
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein TOMM22 is shown in green and the microtubules in red. The image to the left show cells transfected with control siRNA and the image to the right show cells where TOMM22 has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:141
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells..
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN