HPA003037

TOMM22 antibody from Sigma-Aldrich
TOM22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003037
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003037, RRID:AB_1080329
Product name
Anti-TOMM22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003037
Antibody type
Polyclonal
Antigen
Mitochondrial import receptor subunit TOM22 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEED
DDEELDETLSERLWGLTEMFPERVRSAAGATFDLS
LFVAQK
Storage
-20C
Provider Type Product Number
- No reagents -