HPA017760

SLFN5 antibody from Sigma-Aldrich
MGC19764
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017760
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017760, RRID:AB_2189993
Product name
Anti-SLFN5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017760
Antibody type
Polyclonal
Antigen
Schlafen family member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNT
EAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKC
RTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAA
LFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVK
D
Storage
-20C
Provider Type Product Number
- No reagents -