HPA017760

SLFN5 antibody from Atlas Antibodies
MGC19764
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017760
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017760, RRID:AB_1235488
Product name
Anti-SLFN5
Provider product page
Atlas Antibodies - HPA017760
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERHGVGLDVPPIFRSHLDKMQKENHFLIFVKSWNT
EAGVPLATLCSNLYHRERTSTDVMDSQEALAFLKC
RTQTPTNINVSNSLGPQAAQGSVQYEGNINVSAAA
LFDRKRLQYLEKLNLPESTHVEFVMFSTDVSHCVK
D
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -