Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002648-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002648-M01, RRID:AB_913557
- Product name
- GCN5L2 monoclonal antibody (M01), clone 4D3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GCN5L2.
- Antigen sequence
- KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFP
 IDLKTMTERLRSRYYVTRKLFVADLQRVIANCREY
 NPPDSEYCRCASALEKFFYFKLKEGGLIDK
- Isotype
- IgG
- Antibody clone number
- 4D3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- GCN5L2 monoclonal antibody (M01), clone 4D3 Western Blot analysis of GCN5L2 expression in K-562 ( Cat # L009V1 ).
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Immunofluorescence of monoclonal antibody to GCN5L2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol