HPA014572

BMP1 antibody from Sigma-Aldrich
PCOLC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014572
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014572, RRID:AB_1845390
Product name
Anti-BMP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014572
Antibody type
Polyclonal
Antigen
Bone morphogenetic protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQA
VDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQR
GACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGG
NFTGS
Storage
-20C
Provider Type Product Number
- No reagents -