HPA014572

BMP1 antibody from Atlas Antibodies
BMP-1, PCOLC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014572
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014572, RRID:AB_1845390
Product name
Anti-BMP1
Provider product page
Atlas Antibodies - HPA014572
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQA
VDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQR
GACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGG
NFTGS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -