Antibody data

Product number
H00008675-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008675-M03, RRID:AB_1581091
Product name
STX16 monoclonal antibody (M03), clone 3D12
Provider product page
Abnova Corporation - H00008675-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant STX16.
Antigen sequence
MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMAL
VSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGR
IKQKMKELASLHDKHLNRPTLDDSSEEEH
Isotype
IgG
Antibody clone number
3D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -