Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057522-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057522-M03, RRID:AB_535048
- Product name
- SRGAP1 monoclonal antibody (M03), clone 5D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SRGAP1.
- Antigen sequence
PLDPETIAQDIEETMNTALNELRELERQSTAKHAP
DVVLDTLEQVKNSPTPATSTESLSPLHNVALRSSE
PQIRRSTSSSSDTMSTFKPMVAPRMGVQL- Isotype
- IgG
- Antibody clone number
- 5D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A link between the nuclear-localized srGAP3 and the SWI/SNF chromatin remodeler Brg1.
Dai YK, Ma Y, Chen K, Mi YJ, Fu HL, Cui DX, Jin WL
Molecular and cellular neurosciences 2014 May;60:10-25
Molecular and cellular neurosciences 2014 May;60:10-25
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SRGAP1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to SRGAP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol