HPA014574

PXDC1 antibody from Sigma-Aldrich
C6orf145
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014574
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014574, RRID:AB_1845731
Product name
Anti-C6orf145 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014574
Antibody type
Polyclonal
Antigen
PX domain-containing protein C6orf145 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISEIMRSNGFCLANTETIVIDHSIPNGRDQQLGVD
PTEHLFENGSEFPSELEDGDDPAAYVTNLSYYHLV
PFETDIWD
Storage
-20C
Provider Type Product Number
- No reagents -