Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003833-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003833-M01, RRID:AB_464272
- Product name
- KIFC1 monoclonal antibody (M01), clone 2B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KIFC1.
- Antigen sequence
MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRL
KRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVP
SLTTVPQTQGQTTAQKVSKKTGPRCSTAIA- Isotype
- IgG
- Antibody clone number
- 2B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The presence of kinesin superfamily motor proteins KIFC1 and KIF17 in normal and pathological human placenta.
Sati L, Seval-Celik Y, Unek G, Korgun ET, Demir R
Placenta 2009 Oct;30(10):848-54
Placenta 2009 Oct;30(10):848-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KIFC1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to KIFC1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to KIFC1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol