Antibody data

Product number
H00023769-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023769-M04, RRID:AB_530046
Product name
FLRT1 monoclonal antibody (M04), clone 4E10
Provider product page
Abnova Corporation - H00023769-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant FLRT1.
Antigen sequence
MVVAHPTATATTTPTATVTATVVMTTATMDLRDWL
FLCYGLIAFLTEVIDSTTCPSVCRCDNGFIYCNDR
GLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTK
VNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVR
TIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFAD
SKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRI
STIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFS
RLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDN
AISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFD
DLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVV
NVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQG
GVANAAAKTTASNHASATTPQGSLFTLKAKRPGLR
LPDSNIDYPMATGDGAKTLAIHVKALTADSIRITW
KATLPASSFRLSWLRLGHSPAVGSITETLVQGDKT
EYLLTALEPKSTYIICMVTMETSNAYVADETPVCA
KAETADSYGPTTTLNQEQNAGPMASLPLAGIIGGA
VALVFLFLVLGAICWYVHQAGELLTRERAYNRGSR
KKDDYMESGTKKDNSILEIRGPGLQMLPINPYRAK
EEYVVHTIFPSNGSSLCKATHTIGYGTTRGYRDGG
IPDIDYSYT
Isotype
IgG
Antibody clone number
4E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.