HPA054589

FLRT1 antibody from Atlas Antibodies
MGC21624, SPG68

Antibody data

Product number
HPA054589
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA054589, RRID:AB_2682533
Product name
Anti-FLRT1
Provider product page
Atlas Antibodies - HPA054589
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAIKDITSEMDECFETGPQGGVANAAAKTTASNHA
SATTPQGSLFTLKAK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.