HPA017765

GIMAP8 antibody from Sigma-Aldrich
DKFZp667I133, hIAN6, IAN9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017765
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017765, RRID:AB_1849683
Product name
Anti-GIMAP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017765
Antibody type
Polyclonal
Antigen
GTPase, IMAP family member 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWVLRERKVVVIDTPDLFSSIACAEDKQRNIQHCL
ELSAPSLHALLLVIAIGHFTREDEETAKGIQQVFG
AEARRHIIIVFTRKDDLGDDLLQDFIEKNKPLKQL
VQDYEGRYCIFNNKTNSKDEQITQVLELLRKVESL
VNT
Storage
-20C
Provider Type Product Number
- No reagents -