HPA014474

GIMAP8 antibody from Atlas Antibodies
DKFZp667I133, hIAN6, IAN9
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014474
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014474, RRID:AB_1849685
Product name
Anti-GIMAP8
Provider product page
Atlas Antibodies - HPA014474
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDISSLKNIDSEVRKHICTGPHAFLLVTPLGFYTK
NDEAVLSTIQNNFGEKFFEYMIILLTRKEDLGDQD
LDTFLRNSNKALYGLIQKCKNRYSAFNYRATGEEE
QRQADELLEKIESMVHQNGNK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -