WH0079716M1

NPEPL1 antibody from Sigma-Aldrich
bA261P9.2, FLJ11583
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider

Antibody data

Product number
WH0079716M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0079716M1, RRID:AB_1842716
Product name
Monoclonal Anti-NPEPL1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0079716M1
Antibody type
Monoclonal
Antigen
NPEPL1 (AAH20507, a.a. 1-524) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVP
WSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLY
LNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPP
GAHRCIVMVCEQPEVFASACALARAFPLFTHRSGA
SRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANAT
DGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGI
IPTIIRDEELKTRGFGGIYGVGKAALHPPALAVLS
HTPDGATQTI (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -